PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.1G381300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 148aa    MW: 17023.3 Da    PI: 12.066
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.1G381300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.49.4e-152671348
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +WT+eEd +l ++ +++G ++W+++a+ + +gR+  qc++rw+ +l
  Sevir.1G381300.1.p 26 AWTAEEDARLERLAREHGCRHWRRVAASLLTGRSSRQCRDRWRHHL 71
                        7*****************************************9886 PP

2Myb_DNA-binding21.65.2e-0779122348
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         ++T+ +d+ l+++  ++ g+ W+ I+r +  gRt    + rw+ ++
  Sevir.1G381300.1.p  79 PFTARDDDDLARLYVRHAGR-WRDISRAVH-GRTSRAMRRRWRELR 122
                         79****************99.*********.***********9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.3231675IPR017930Myb domain
SMARTSM007173.8E-112373IPR001005SANT/Myb domain
SuperFamilySSF466898.24E-2224118IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.5E-172681IPR009057Homeodomain-like
CDDcd001676.47E-102671No hitNo description
PfamPF002493.1E-132671IPR001005SANT/Myb domain
PROSITE profilePS500906.87672122IPR017877Myb-like domain
SMARTSM007170.004976124IPR001005SANT/Myb domain
CDDcd001670.0079579121No hitNo description
PfamPF139211.1E-680124No hitNo description
Gene3DG3DSA:1.10.10.605.3E-982121IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
MASASAAAGL APSAAAPVLR IRPPPAWTAE EDARLERLAR EHGCRHWRRV AASLLTGRSS  60
RQCRDRWRHH LARDVYHRPF TARDDDDLAR LYVRHAGRWR DISRAVHGRT SRAMRRRWRE  120
LRDSDAFLSK LWRPRPPPPA PWTDADA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3osg_D3e-142712314108MYB21
3osg_A3e-142712314108MYB21
3osf_D3e-142712314108MYB21
3osf_A3e-142712314108MYB21
3zqc_J3e-1427119596MYB3
3zqc_G3e-1427119596MYB3
3zqc_D3e-1427119596MYB3
3zqc_A3e-1427119596MYB3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012701216.13e-97PREDICTED: myb-like protein AA
TrEMBLK3Z0K02e-96K3Z0K0_SETIT; Uncharacterized protein
STRINGSi020066m7e-96(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP125692035
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.13e-15myb domain protein r1